PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014326
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family BES1
Protein Properties Length: 234aa    MW: 24587.4 Da    PI: 6.931
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014326genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82233.61.4e-1057771147
       DUF822  71 kgskpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvs 147
                  +g+kpl   e+ag+  s s  ss+q s+++s+++spv sy+asp+sssfpsps+++ +++a    llp+l++ ++++
  Lus10014326   5 QGCKPL-PGEIAGTPLSFSGGSSIQPSPQTSNFQSPVISYQASPTSSSFPSPSRFEANPSA---YLLPLLRNIASIP 77 
                  89****.*************************************************99885...8889888887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.7E-7560IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MICSQGCKPL PGEIAGTPLS FSGGSSIQPS PQTSNFQSPV ISYQASPTSS SFPSPSRFEA  60
NPSAYLLPLL RNIASIPTNL PPLRISNSAP VTPPLSSPTR NSNASLANNA TIVNSFNHPI  120
FAASAPSSPT RRHHYFQPIP ECDESDGSII DSGGWLSFQG VPSSQTIPVS PTFNLVRPVV  180
GANVNAAASG VDNVRSSEFE FGNRKVKPWE GERIHEMGTD DLELTLASGK ARG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349751.18e-80PREDICTED: BES1/BZR1 homolog protein 2-like
SwissprotQ8S3076e-66BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA9P7X73e-77A9P7X7_POPTR; Uncharacterized protein
STRINGPOPTR_0007s12370.18e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.25e-67BES1 family protein